The domain within your query sequence starts at position 138 and ends at position 177; the E-value for the SBF2 domain shown below is 1.6e-13.
GPPVVSIMEKVITVFNSAQRLEVVRNCISFIFENKTLETE
SBF2 |
![]() |
---|
PFAM accession number: | PF12335 |
---|---|
Interpro abstract (IPR022096): | This domain family is found in eukaryotes, and is approximately 220 amino acids in length. It is found in association with . It is found is the middle region of SBF1 and SBF2, members of the myotubularin family. Myotubularin-related proteins have been suggested to work in phosphoinositide-mediated signalling events that may also convey control of myelination. Mutations of SBF2 are implicated in Charcot-Marie-Tooth disease [ (PUBMED:12554688) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SBF2