SMART: Pfam domain SBF2

The domain within your query sequence starts at position 482 and ends at position 706; the E-value for the SBF2 domain shown below is 1.6e-107.

PAGPPVVSIMEKVITVFNSAQRLEVVRNCISFIFENKTLETEKTLPAALRALKGKAARQC
LTDELGLHVQQNRAILDHQQFDYIIRMMNCTLQDCSSLEEYNIAAALLPLTSAFYRKLAP
GVSQFAYTCVQDHPIWTNQQFWETTFYNAVQEQVRSLYLSAKDDNHIPHLKQKLPDGQHQ
EKTAMDLAAEQLRLWPTLSKSTQQELVQHEESTVFSQAIHFANLM

SBF2

PFAM accession number:	PF12335
Interpro abstract (IPR022096):	This domain family is found in eukaryotes, and is approximately 220 amino acids in length. It is found in association with . It is found is the middle region of SBF1 and SBF2, members of the myotubularin family. Myotubularin-related proteins have been suggested to work in phosphoinositide-mediated signalling events that may also convey control of myelination. Mutations of SBF2 are implicated in Charcot-Marie-Tooth disease [ (PUBMED:12554688) ].

PFAM accession number:

PF12335

Interpro abstract (IPR022096):

This domain family is found in eukaryotes, and is approximately 220 amino acids in length. It is found in association with . It is found is the middle region of SBF1 and SBF2, members of the myotubularin family. Myotubularin-related proteins have been suggested to work in phosphoinositide-mediated signalling events that may also convey control of myelination. Mutations of SBF2 are implicated in Charcot-Marie-Tooth disease [ (PUBMED:12554688) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SBF2