The domain within your query sequence starts at position 135 and ends at position 310; the E-value for the SCAMP domain shown below is 1.1e-67.
QNNWPPLPSFCPVKPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLLNFFACLARFCV DTGSGSGFGLSMLWLLLFTPCSFVCWYRPMYKAFRSDSSFNFFVFFFIFFVQDVFFVLQA IGIPGWGFSGWVTALVVVGSKPAVAVLMLLVALLFTGIAVLGIVMLKRIHSLYRQT
SCAMP |
---|
PFAM accession number: | PF04144 |
---|---|
Interpro abstract (IPR007273): | In vertebrates, secretory carrier membrane proteins (SCAMPs) 1-3 constitute a family of putative membrane-trafficking proteins composed of cytoplasmic N-terminal sequences with NPF repeats, four central transmembrane regions (TMRs), and a cytoplasmic tail. SCAMPs probably function in endocytosis by recruiting EH-domain proteins to the N-terminal NPF repeats but may have additional functions mediated by their other sequences [ (PUBMED:11050114) ]. |
GO process: | protein transport (GO:0015031) |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SCAMP