The domain within your query sequence starts at position 200 and ends at position 235; the E-value for the SHIPPO-rpt domain shown below is 1.7e0.

GPGPGQYDIIQKRKLHCENINIKREQEHNYYTYVPR

SHIPPO-rpt

SHIPPO-rpt
PFAM accession number:PF07004
Interpro abstract (IPR010736):

This entry represents a short conserved region carrying a PGP motif that is repeated in the eukaryotic sperm tail protein, outer dense fibre protein 3 [ (PUBMED:11870087) ]. Orthologues from some species may include up to 40 Pro-Gly-Pro repeats.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SHIPPO-rpt