The domain within your query sequence starts at position 62 and ends at position 92; the E-value for the SHIPPO-rpt domain shown below is 1.3e1.
VPGPAHYNVSQAQYNIRGGRSLQNREKRFKK
SHIPPO-rpt |
---|
PFAM accession number: | PF07004 |
---|---|
Interpro abstract (IPR010736): | This entry represents a short conserved region carrying a PGP motif that is repeated in the eukaryotic sperm tail protein, outer dense fibre protein 3 [ (PUBMED:11870087) ]. Orthologues from some species may include up to 40 Pro-Gly-Pro repeats. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SHIPPO-rpt