The domain within your query sequence starts at position 20 and ends at position 268; the E-value for the SHMT domain shown below is 6.4e-137.
LKDSDAEVYSIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGG TEFIDELEMLCQKRALQAYHLDPQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPD GGHLTHGFMTDKKKISATSIFFESMPYKVYPETGYINYDQLEENASLFHPKLIIAGTSCY SRNLDYARLRKIADDNGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAG MIFYRKGVA
SHMT |
![]() |
---|
PFAM accession number: | PF00464 |
---|---|
Interpro abstract (IPR039429): | Proteins containing this domain include serine hydroxymethyltransferase and fluorothreonine transaldolase. Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate-dependent enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and methylenetetrahydrofolate [ (PUBMED:11063567) ]. This reaction generates single carbon units for purine, thymidine, and methionine biosynthesis. It belongs to the aspartate aminotransferase superfamily (fold type I) [ (PUBMED:10828359) ]. The pyridoxal-P group is attached to a lysine residue around which the sequence is highly conserved in all forms of the enzyme [ (PUBMED:8305478) ]. SHMT catalyses the transfer of a hydroxymethyl group from N5, N10- methylene tetrahydrofolate to glycine, resulting in the formation of serine and tetrahydrofolate. Both eukaryotic and prokaryotic SHMT enzymes form tight obligate homodimers and the mammalian enzyme forms a homotetramer [ (PUBMED:10828359) (PUBMED:11877399) ]. Fluorothreonine transaldolase catalyzes the final step in 4-fluorothreonine biosynthesis. It mediates a L-threonine/fluoroaceldehyde to 4-fluoro-L-threonine/acetaldehyde crossover reaction. It shares protein sequence similarity with SHMT [ (PUBMED:19101471) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SHMT