The domain within your query sequence starts at position 237 and ends at position 308; the E-value for the SHQ1 domain shown below is 1e-19.
EQGDSAALGKSAVLKCLLDVHKVFQENDPAYILNDLYISDYCVWIQKAKSKKLAALTEAL KAVSLSKAQLGL
SHQ1 |
![]() |
---|
PFAM accession number: | PF04925 |
---|---|
Interpro abstract (IPR007009): | This conserved region identifies a set of hypothetical protein sequences from the Metazoa and Ascomycota which include SHQ1 from Saccharomyces cerevisiae. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SHQ1