The domain within your query sequence starts at position 1 and ends at position 221; the E-value for the SID-1_RNA_chan domain shown below is 4.7e-29.
XITVQRKDFPSNSFYVVVVVKTEDQACGGSLPFYPFVEDEPVDQGHRQKTLSVLVSQAVT SEAYVGGMLFCLGIFLSFYLLTVLLACWENWRQRKKTLLLAIDRACPESASLLGHARVLA DSFPGSAPYEGYNYGSFENGSGSTDGLVESAGSGDLSYSYQGHDQFKRRLPSGQMRQLCI AMDRSFDAVGPRPRLDSMSSVEEDDYDTLTDIDSDKNVIRT
SID-1_RNA_chan |
---|
PFAM accession number: | PF13965 |
---|---|
Interpro abstract (IPR025958): | This is a family of proteins that are transmembrane dsRNA-gated channels. They passively transport dsRNA into cells and do not act as ATP-dependent pumps [ (PUBMED:12970568) ]. They are required for systemic RNA interference [ (PUBMED:11834782) (PUBMED:16202143) (PUBMED:23396108) ]. This entry also includes CHUP-1 from C. elegans. CHUP-1 is the SID-1 paralog. However, it does not transport dsRNA [ (PUBMED:29025917) ]. Instead, it is involved in dietary cholesterol uptake [ (PUBMED:22479487) ]. |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SID-1_RNA_chan