SMART: Pfam domain SIX1

The domain within your query sequence starts at position 9 and ends at position 119; the E-value for the SIX1_SD domain shown below is 1.5e-52.

FTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYK
ILESHQFSPHNHAKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPR

SIX1_SD

PFAM accession number:	PF16878
Interpro abstract (IPR031701):	The SD domain is found N-terminal to the homeobox domain in the protein SIX1. As a transcription factor, SIX1 lacks intrinsic activation domains and thus needs to bind to the EYA family of co-factors in order to mediate transcriptional activation. The SD domain is necessary for this protein-protein interaction, binding to the C-terminal region of EYA (Eyes absent homologue proteins) [ (PUBMED:23435380) ].

PFAM accession number:

PF16878

Interpro abstract (IPR031701):

The SD domain is found N-terminal to the homeobox domain in the protein SIX1. As a transcription factor, SIX1 lacks intrinsic activation domains and thus needs to bind to the EYA family of co-factors in order to mediate transcriptional activation. The SD domain is necessary for this protein-protein interaction, binding to the C-terminal region of EYA (Eyes absent homologue proteins) [ (PUBMED:23435380) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SIX1_SD