The domain within your query sequence starts at position 175 and ends at position 335; the E-value for the SKIP_SNW domain shown below is 2e-78.

QYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPS
RKMTVKEQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIA
DRKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERR

SKIP_SNW

• PFAM accession number: PF02731
• Interpro abstract (IPR004015):

  SKIP (SKI-interacting protein) is an essential spliceosomal component and transcriptional coregulator, which may provide regulatory coupling of transcription initiation and splicing [ (PUBMED:15052407) ]. SKIP was identified in a yeast 2-hybrid screen, where it was shown to interact with both the cellular and viral forms of SKI through the highly conserved region on SKIP known as the SNW domain [ (PUBMED:11522815) ]. SKIP is now known to interact with a number of other proteins as well. SKIP potentiates the activity of important transcription factors, such as vitamin D receptor, CBF1 (RBP-Jkappa), Smad2/3, and MyoD. It works with Ski in overcoming pRb-mediated cell cycle arrest, and it is targeted by the viral transactivators EBNA2 and E7 [ (PUBMED:10644367) ].

  This entry represents the SNW domain.

• GO process: mRNA splicing, via spliceosome (GO:0000398)
• GO component: spliceosomal complex (GO:0005681)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SKIP_SNW