The domain within your query sequence starts at position 829 and ends at position 1087; the E-value for the SLC12 domain shown below is 4.8e-33.
VPKNIAFYPSNHERYLDGHIDVWWIVHDGGMLMLLPFLLRQHKVWKKCRMRIFTVAQMDD NSIQMKKDLAIFLYHLRLEAEVEVVEMHNSDISAYTYERTLMMEQRSQMLRQMRLTKTER DREAQLVKDRHSALRLESLYSDEEEESVAGADKIQMTWTRDKYMAEPWDPSHAPDNFREL VHIKPDQSNVRRMHTAVKLNEVIVTRSHDARLVLLNMPGPPKNSEGDENYMEFLEVLTEG LERVLLVRGGGREVITIYS
SLC12 |
---|
PFAM accession number: | PF03522 |
---|---|
Interpro abstract (IPR018491): | This entry represents a domain found in the C-terminal of the solute carrier family 12 (SLC12) members, which are K-Cl cotransporters. The SLC12 family members are predicted to have 12 transmembrane (TM) regions in a central hydrophobic domain, together with hydrophilic N- and C-termini that are likely cytoplasmic. Comparison of their sequences with those of other ion-tranporting membrane proteins reveals that they are part of a new superfamily of cation-chloride co-transporters, which includes the Na-Cl and Na-K-2Cl co-transporters [ (PUBMED:8663311) (PUBMED:9930699) (PUBMED:10600773) ]. |
GO process: | ion transport (GO:0006811) |
GO component: | membrane (GO:0016020) |
GO function: | transmembrane transporter activity (GO:0022857) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SLC12