The domain within your query sequence starts at position 87 and ends at position 210; the E-value for the SLX9 domain shown below is 8e-27.
KAILPKKEKLKLRRERWLQKIEAIKLAEQKLREERKRKAMVVVGDLHPLRDALPELQELE AGRQRQQARRRVTSKPRPVELSRMTTVQRQQLLEEERTRFQKLLASPTYRASPLLAIGQQ LAHQ
SLX9 |
 |
|---|
| PFAM accession number: | PF15341 |
|---|---|
| Interpro abstract (IPR028160): | Slx9 is required for pre-rRNA processing. In Saccharomyces cerevisiae, Slx9 is associated with the 90S pre-ribosome and 43S small ribosomal subunit precursor [ (PUBMED:17018574) ]. The early stages of ribosomes biogenesis includes processing of the 35S pre-ribosomal RNA transcript into the mature 18S, 5.8S, and 25S rRNA molecules. The 35S precursor contains external transcribed spacer elements (5' and 3'-ETS) at either end as well as internal transcribed spacers (ITS1 and ITS2) that separate the mature sequences [ (PUBMED:17018574) ]. Slx9 is implicated in the processing events that remove the ITS1 spacer sequences [ (PUBMED:17018574) ]. This entry also includes the FAM207A proteins from mammals. |
| GO process: | maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO:0000462) |
| GO component: | 90S preribosome (GO:0030686), nucleolus (GO:0005730), preribosome, small subunit precursor (GO:0030688) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SLX9