SMART: Pfam domain SMC

The domain within your query sequence starts at position 738 and ends at position 1247; the E-value for the SMC_N domain shown below is 1.1e-35.

SSVIDEISVEEVNKMESQLERHSKQAMQIQEQKVQHEEAVVKLRHSERDMRNTLEKFAAS
IQGLSEQEEYLCVQIKELEANVLTTAPDRKQQKLLEENVSVFKKEYDAVAEKAGKVEAEI
KRLHNTIIDINNRKLKAQQNKLDTINKQLDECASAITKAQVAIKTADRNLKKAQDSVCRT
EKEIKDTEKEINDLKTELKNIEDKAEEVINNTKTAETSLPEIQKEHRNLLQELKVIQENE
HALQKDALSIKLKLEQIDGHISEHNSKIKYWQKEISKIKLHPVEDNPVETVAVLSQEELE
AIKNPESITNEIALLEAQCREMKPNLGAIAEYKKKEDLYLQRVAELDKITSERDNFRQAY
EDLRKQRLNEFMAGFYVITNKLKENYQMLTLGGDAELELVDSLDPFSEGIMFSVRPPKKS
WKKIFNLSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNVSIVAFYIYEQTKNA
QFIIISLRNNMFEISDRLIGIYKTYNSTKS

SMC_N

PFAM accession number:	PF02463
Interpro abstract (IPR003395):	This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [ (PUBMED:11983169) ]. The eukaryotic SMC proteins form two kind of heterodimers: the SMC1/SMC3 and the SMC2/SMC4 types. These heterodimers constitute an essential part of higher order complexes, which are involved in chromatin and DNA dynamics [ (PUBMED:10429180) ]. This domain is also found in RecF and RecN proteins, which are involved in DNA metabolism and recombination.

PFAM accession number:

PF02463

Interpro abstract (IPR003395):

This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [ (PUBMED:11983169) ]. The eukaryotic SMC proteins form two kind of heterodimers: the SMC1/SMC3 and the SMC2/SMC4 types. These heterodimers constitute an essential part of higher order complexes, which are involved in chromatin and DNA dynamics [ (PUBMED:10429180) ]. This domain is also found in RecF and RecN proteins, which are involved in DNA metabolism and recombination.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SMC_N