The domain within your query sequence starts at position 62 and ends at position 183; the E-value for the SNARE_assoc domain shown below is 6e-27.
IPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCYMLSYLVGRPVVYKYLTEKAVKWSQ QVERHREHLINYIIFLRITPFLPNWFINITSPVINVPLKVFFIGTFLGVAPPSFVAIKAG TT
SNARE_assoc |
 |
|---|
| PFAM accession number: | PF09335 |
|---|---|
| Interpro abstract (IPR032816): | This is a family of SNARE associated Golgi proteins. The yeast member of this family,Tvp38, localises with the t-SNARE Tlg2 [ (PUBMED:16107716) ] and is involved in vesicular trafficking and spindle migration [ (PUBMED:17178117) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SNARE_assoc