SMART: Pfam domain SNF2

The domain within your query sequence starts at position 101 and ends at position 195; the E-value for the SNF2_N domain shown below is 2.1e-8.

LASAFQLSEDGDSIPYTINRYLRDYQREGAQFLYRHYIEGRGCILGDDMGLGKTIQVISF
LAAVLHKKGTREDIENNMPEFLLKSMKKKPPSTAK

SNF2_N

PFAM accession number:	PF00176
Interpro abstract (IPR000330):	This domain is found in proteins involved in a variety of processes including transcription regulation (e.g., SNF2, STH1, brahma, MOT1), DNA repair (e.g., ERCC6, RAD16, RAD5), DNA recombination (e.g., RAD54), and chromatin unwinding (e.g., ISWI) as well as a variety of other proteins with little functional information (e.g., lodestar, ETL1) [ (PUBMED:7651832) (PUBMED:14729263) ]. SNF2 functions as the ATPase component of the SNF2/SWI multisubunit complex, which utilises energy derived from ATP hydrolysis to disrupt histone-DNA interactions, resulting in the increased accessibility of DNA to transcription factors. Proteins that contain this domain appear to be distantly related to the DEAX box helicases.
GO function:	ATP binding (GO:0005524)

PFAM accession number:

PF00176

Interpro abstract (IPR000330):

This domain is found in proteins involved in a variety of processes including transcription regulation (e.g., SNF2, STH1, brahma, MOT1), DNA repair (e.g., ERCC6, RAD16, RAD5), DNA recombination (e.g., RAD54), and chromatin unwinding (e.g., ISWI) as well as a variety of other proteins with little functional information (e.g., lodestar, ETL1) [ (PUBMED:7651832) (PUBMED:14729263) ]. SNF2 functions as the ATPase component of the SNF2/SWI multisubunit complex, which utilises energy derived from ATP hydrolysis to disrupt histone-DNA interactions, resulting in the increased accessibility of DNA to transcription factors.

Proteins that contain this domain appear to be distantly related to the DEAX box helicases.

GO function:

ATP binding (GO:0005524)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SNF2_N