The domain within your query sequence starts at position 1 and ends at position 70; the E-value for the SNURF domain shown below is 4.4e-50.
MERGRDRLHLRRTTEQHVPEVEVQVKRRRTASLSNQECHLYPRRSQQQQVPVVDFQAELR QAFLAETPRG
SNURF |
 |
|---|
| PFAM accession number: | PF07192 |
|---|---|
| Interpro abstract (IPR009847): | This family consists of several mammalian SNRPN upstream reading frame (SNURF) proteins. SNURF or RPF4 is a RING-finger protein and a coregulator of androgen receptor-dependent transcription. It has been suggested that SNURF is involved in the regulation of processes required for late steps of spermatid maturation [ (PUBMED:12351196) (PUBMED:12874792) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SNURF