SMART: Pfam domain SOBP

The domain within your query sequence starts at position 224 and ends at position 543; the E-value for the SOBP domain shown below is 1.5e-88.

VCDWCKHIRHTKEYLDFGDGERRLQFCSAKCLNQYKMDIFYKETQANLPAGLCSTLHPHM
ESKAEGTGVQLLTPDSWNIPLTDARRKAPSPVTAAGQSQGPGPSSSTTVSPSDTANCSVT
KIPTPVPKSLPISETPSIPPVSVQPPASIGPPLGVPPRSPPMVMTNRGPVPLPIFMEQQI
IQQIRPPFIRGPPHHASNPNSPLSNPMLPGIGAPPGGPRNLGPTSSPMHRPMLSPHIHPP
STPTMPGNPPGLLPPPPPGAPLPSLPFPPVSMMPNGPMPVPQMMNFGLPSLAPLVPPPTL
LVPYPVIVPLPVPIPIPIPI

SOBP

PFAM accession number:	PF15279
Interpro abstract (IPR026092):	Retinoic acid (RA) has been shown to modulate the expression of a number of proteins implicated in the control of early embryonic development. One of these is retinoic acid-induced protein 2 (RAI2), which has been isolated in mouse [ (PUBMED:8314004) ] and humans [ (PUBMED:10049581) ]. Sine oculis-binding protein homologue (Jxc1, SOBP) is implicated in the development of the cochlea in the inner ear [ (PUBMED:16962269) ]. Mutations in this gene also cause intellectual disability (ID) [ (PUBMED:21035105) ].

PFAM accession number:

PF15279

Interpro abstract (IPR026092):

Retinoic acid (RA) has been shown to modulate the expression of a number of proteins implicated in the control of early embryonic development. One of these is retinoic acid-induced protein 2 (RAI2), which has been isolated in mouse [ (PUBMED:8314004) ] and humans [ (PUBMED:10049581) ].

Sine oculis-binding protein homologue (Jxc1, SOBP) is implicated in the development of the cochlea in the inner ear [ (PUBMED:16962269) ]. Mutations in this gene also cause intellectual disability (ID) [ (PUBMED:21035105) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SOBP