The domain within your query sequence starts at position 19 and ends at position 122; the E-value for the SPACA7 domain shown below is 4.7e-34.
WQDVQPWPNRELSGSSGKQWPNLETLDDDIATVFDEILVRDILEPGKAPYFENQSPSTTS QQKTTKEKEVHTKEPIPSKTYQKQSSSGTMHTPSFDDKQKEILF
SPACA7 |
---|
PFAM accession number: | PF15307 |
---|---|
Interpro abstract (IPR029301): | Sperm acrosome associated 7 (SPACA7) is expressed only in testis. Its release from the acrosome accelerates the dispersal of cumulus cells surrounding the oocyte and facilitates fertilisation in mice [ (PUBMED:24307706) ]. |
GO component: | acrosomal vesicle (GO:0001669) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPACA7