The domain within your query sequence starts at position 279 and ends at position 428; the E-value for the SPATA1_C domain shown below is 1.7e-56.
EQMKQVKEERKYLENIREELIKKVDKLFEQNKSKRYHASDSWKKKYLDTKKVTASLEEVL TKLREDLELYYKKLLMQLEAREIKMRPRNLANISDSKNYLIIQITEVQHAIDQLKRKLDT DKMKLILEVKMRKQAVSDLQTLKADLTQKK
SPATA1_C |
---|
PFAM accession number: | PF15743 |
---|---|
Interpro abstract (IPR031478): | The spermatogenesis associated 1 (SPATA1) protein is thought to be involved in spermatogenesis and is a potential marker for male fertility [ (PUBMED:19220231) ]. This entry represents the C-terminal domain of SPATA1. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPATA1_C