The domain within your query sequence starts at position 11 and ends at position 149; the E-value for the SPATA6 domain shown below is 3.4e-56.
LALEIRSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPEAVD PGDVVAQLEYDTAVFELIQLVPPVGETLSTYDENTRDFMFPGPNQMSGHHDSNRQVTMRR ISGLRGIAPKLEFSTTSVI
SPATA6 |
---|
PFAM accession number: | PF14909 |
---|---|
Interpro abstract (IPR032732): | This domain is found in the spermatogenesis associated protein 6 (Spata6) from eukaryotes, and is approximately 140 amino acids in length. Spata6 has similarity with the motor domain of kinesin related proteins and the Caenorhabditis elegans neural calcium sensor protein (NCS-2) [ (PUBMED:12771232) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPATA6