The domain within your query sequence starts at position 22 and ends at position 135; the E-value for the SPR1 domain shown below is 1.3e-56.
GNGDPSPGSTDTHEEEDSPPLPLGPPIPGDPWPGAPPLFDEPPPPGSNRPWRDLPDSGAW PPKPPSTDPPKPPLPDDPWPAGTQPPENPWPPAPEMDHESQEEPDLDPPQEEYR
SPR1 |
 |
|---|
| PFAM accession number: | PF15356 |
|---|---|
| Interpro abstract (IPR029271): | This entry represents SPR1, which is the psoriasis susceptibility locus 2 protein [ (PUBMED:12930300) ]. Its function is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SPR1