SMART: Pfam domain SRA1

The domain within your query sequence starts at position 65 and ends at position 208; the E-value for the SRA1 domain shown below is 1e-67.

VDHPPPSSKASRPPPMGSCPATGVEPPSSPVIESETLIEDVLRPLEQALEDCHGHTKVCD
DISRRLALLREQWAGGKLSIPVKKRMALLVQELLHHQWDAADDIHRSLMVDHVTEVSQWM
VGVKRLIAEKKSLSSEETKEEKFT

SRA1

PFAM accession number:	PF07304
Interpro abstract (IPR009917):	This domain can be found in several hypothetical mammalian steroid receptor RNA activator proteins. The SRA-RNAs encode stable proteins that are widely expressed and upregulated in breast cancer cell lines. SRA-RNA is a steroid receptor co-activator which acts as a functional RNA [ (PUBMED:27282881) ]. This domain is also found at the C terminus of Sec31, a component of the coat protein complex II (COPII, which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). COPII has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules [ (PUBMED:9190202) ].

PFAM accession number:

PF07304

Interpro abstract (IPR009917):

This domain can be found in several hypothetical mammalian steroid receptor RNA activator proteins. The SRA-RNAs encode stable proteins that are widely expressed and upregulated in breast cancer cell lines. SRA-RNA is a steroid receptor co-activator which acts as a functional RNA [ (PUBMED:27282881) ].

This domain is also found at the C terminus of Sec31, a component of the coat protein complex II (COPII, which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). COPII has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules [ (PUBMED:9190202) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SRA1