SMART: Pfam domain SRP40

The domain within your query sequence starts at position 627 and ends at position 699; the E-value for the SRP40_C domain shown below is 1.1e-32.

PFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYR
GGSISVQVNSVKF

SRP40_C

PFAM accession number:	PF05022
Interpro abstract (IPR007718):	This presumed domain is found at the C terminus of the budding yeast Srp40 and mammalian NOLC1 (also known as Nopp140) proteins. They are nucleolar proteins that contain a central domain consisting of ten repeats of acidic serine clusters alternating with lysine-, alanine- and proline-rich basic stretches [ (PUBMED:22906532) ]. Srp40 may be involved in preribosome assembly or transport [ (PUBMED:9364927) ]. Human NOLC1 interacts with casein kinase 2 (CK2), RNA polymerase I, p80 coilin NAP57, and both major classes (box H/ACA and box C/D) of snoRNPs [ (PUBMED:22906532) ]. It acts as a regulator of RNA polymerase I by connecting RNA polymerase I with enzymes responsible for ribosomal processing and modification [ (PUBMED:10567578) (PUBMED:26399832) ].

PFAM accession number:

PF05022

Interpro abstract (IPR007718):

This presumed domain is found at the C terminus of the budding yeast Srp40 and mammalian NOLC1 (also known as Nopp140) proteins. They are nucleolar proteins that contain a central domain consisting of ten repeats of acidic serine clusters alternating with lysine-, alanine- and proline-rich basic stretches [ (PUBMED:22906532) ]. Srp40 may be involved in preribosome assembly or transport [ (PUBMED:9364927) ]. Human NOLC1 interacts with casein kinase 2 (CK2), RNA polymerase I, p80 coilin NAP57, and both major classes (box H/ACA and box C/D) of snoRNPs [ (PUBMED:22906532) ]. It acts as a regulator of RNA polymerase I by connecting RNA polymerase I with enzymes responsible for ribosomal processing and modification [ (PUBMED:10567578) (PUBMED:26399832) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SRP40_C