The domain within your query sequence starts at position 30 and ends at position 157; the E-value for the SRP_TPR_like domain shown below is 5.5e-25.
ALKTVNKILQINKDDVTALHCKVVCLIQNGSFKEALNVINTHTKVLANNSLSFEKAYCEY RLNRIENALKTIESATQQTDKLKELYGQVLYRLERYDECLAVYRDLVRNSQDDYDEERKT NLSAVVAA
SRP_TPR_like |
---|
PFAM accession number: | PF17004 |
---|---|
Interpro abstract (IPR031545): | This entry represents a TPR-like repeats found in a group of eukaryotic proteins. Many sequences are annotated as being signal recognition proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SRP_TPR_like