The domain within your query sequence starts at position 109 and ends at position 162; the E-value for the SRR1 domain shown below is 1.8e-20.
CVCYGLGTFASCPTARIQLAFMLLFLEKCQVPRSHCWVYDPLFSQTEVSVLTSL
SRR1 |
---|
PFAM accession number: | PF07985 |
---|---|
Interpro abstract (IPR012942): | This domain is found in SRR1-like proteins. SRR1 are signalling proteins thought to be involved in regulating the circadian clock input pathway, which is required for normal oscillator function. In Arabidopsis thaliana it regulates the expression of clock-regulated genes such as CCA1 and TOC1. It is also involved in both the phytochrome B (PHYB) and PHYB-independent signaling pathways [ (PUBMED:12533513) ]. The mouse homologue of the plant circadian-regulating protein SRR1 plays roles in heme-regulated circadian rhythms and cell proliferation [ (PUBMED:28802827) ]. The yeast SRR1-like protein Ber1 is involved in microtubule stability [ (PUBMED:18064466) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SRR1