The domain within your query sequence starts at position 135 and ends at position 167; the E-value for the SSXRD domain shown below is 1e-17.

PGGIQVNVWSHRLRERKYRVIYSEISDPEEEED

SSXRD

SSXRD
PFAM accession number:PF09514
Interpro abstract (IPR019041):

Protein SSX1 can repress transcription, and this has been attributed to a putative Kruppel associated box (KRAB) repression domain at the N terminus. However, from the analysis of these deletion constructs further repression activity was found at the C terminus of SSX1. Which has been called the SSXRD (SSX Repression Domain). The potent repression exerted by full-length SSX1 appears to localise to this region [ (PUBMED:9788446) ].

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SSXRD