The domain within your query sequence starts at position 16 and ends at position 82; the E-value for the ST7 domain shown below is 6.3e-33.
IVWSWTYLWTVWFFLVLFLVYILRVPLRINDNLSTVSMFLNTLTPKFYVALTGTSSLISG LILKPEK
ST7 |
![]() |
---|
PFAM accession number: | PF04184 |
---|---|
Interpro abstract (IPR007311): | The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene [ (PUBMED:16474848) ]. The molecular function of this protein is uncertain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ST7