SMART: Pfam domain STAT2

The domain within your query sequence starts at position 853 and ends at position 907; the E-value for the STAT2_C domain shown below is 1.1e-28.

LQQPSESDLPEDLQQISVEDLKKLSNPSTEYITTNENPMLAGESSGDETSIPYHS

STAT2_C

PFAM accession number:	PF12188
Interpro abstract (IPR022756):	This region is found in the mammalian signal transducer and activation of transcription (STAT) 2 protein, and is approximately 60 amino acids in length. The family is found in association with . There is a conserved DLP sequence motif. STATs are involved in transcriptional regulation and are the only regulators known to be modulated by tyrosine phosphorylation. STAT2 forms a trimeric complex with STAT1 and IRF-9 (Interferon Regulatory Factor 9), on activation of the cell by interferon, which is called ISGF3 (Interferon-stimulated gene factor 3). The C-terminal domain of STAT2 contains a nuclear export signal (NES) which allows export of STAT2 into the cytoplasm along with any complexed molecules.

PFAM accession number:

PF12188

Interpro abstract (IPR022756):

This region is found in the mammalian signal transducer and activation of transcription (STAT) 2 protein, and is approximately 60 amino acids in length. The family is found in association with . There is a conserved DLP sequence motif. STATs are involved in transcriptional regulation and are the only regulators known to be modulated by tyrosine phosphorylation. STAT2 forms a trimeric complex with STAT1 and IRF-9 (Interferon Regulatory Factor 9), on activation of the cell by interferon, which is called ISGF3 (Interferon-stimulated gene factor 3). The C-terminal domain of STAT2 contains a nuclear export signal (NES) which allows export of STAT2 into the cytoplasm along with any complexed molecules.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry STAT2_C