SMART: Pfam domain STN1

The domain within your query sequence starts at position 167 and ends at position 330; the E-value for the STN1_2 domain shown below is 2.7e-70.

DPVWNMQIARMLELPKLYQKVYDQPFRNPALQEEEALNNKDNLDLAGLTSLLSEKIKEFL
QEKKMQSFYQQELETVESLQSLASRPVTHSTGSDQVELKDSGTSGVAQRVFKNALQLLQE
KGLVFQRDSGSDKLYYVTTKDKDLQQKIYHIIKEDCQKPNRISW

STN1_2

PFAM accession number:	PF09170
Interpro abstract (IPR015253):	This entry represents the C-terminal domain of Stn1. Stn1 is a component of the CST complex, a complex that binds to single-stranded DNA and is required to protect telomeres from DNA degradation. The CST complex binds single-stranded DNA with high affinity in a sequence-independent manner, while isolated subunits bind DNA with low affinity by themselves. In addition to telomere protection, the CST complex has probably a more general role in DNA metabolism at non-telomeric sites [ (PUBMED:19854130) (PUBMED:19648609) ].

PFAM accession number:

PF09170

Interpro abstract (IPR015253):

This entry represents the C-terminal domain of Stn1.

Stn1 is a component of the CST complex, a complex that binds to single-stranded DNA and is required to protect telomeres from DNA degradation. The CST complex binds single-stranded DNA with high affinity in a sequence-independent manner, while isolated subunits bind DNA with low affinity by themselves. In addition to telomere protection, the CST complex has probably a more general role in DNA metabolism at non-telomeric sites [ (PUBMED:19854130) (PUBMED:19648609) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry STN1_2