SMART: Pfam domain SUV3

The domain within your query sequence starts at position 625 and ends at position 672; the E-value for the SUV3_C domain shown below is 4e-19.

LMDLEAVHDVFDLYLWLSYRFIDMFPDSSLVRSLQKELDAIIQEGVHN

SUV3_C

PFAM accession number:	PF12513
Interpro abstract (IPR022192):	This domain is found in ATP-dependent RNA helicase SUV3. It is found in bacterial and eukaryotic proteins, it is approximately 50 amino acids in length and it is usually found in association with . The yeast mitochondrial degradosome (mtEXO) is an NTP-dependent exoribonuclease involved in mitochondrial RNA metabolism. mtEXO is made up of two subunits: an RNase (DSS1) and an RNA helicase (SUV3). These co-purify with mitochondrial ribosomes [ (PUBMED:12426313) ].
GO function:	hydrolase activity, acting on acid anhydrides (GO:0016817)

PFAM accession number:

PF12513

Interpro abstract (IPR022192):

This domain is found in ATP-dependent RNA helicase SUV3. It is found in bacterial and eukaryotic proteins, it is approximately 50 amino acids in length and it is usually found in association with .

The yeast mitochondrial degradosome (mtEXO) is an NTP-dependent exoribonuclease involved in mitochondrial RNA metabolism. mtEXO is made up of two subunits: an RNase (DSS1) and an RNA helicase (SUV3). These co-purify with mitochondrial ribosomes [ (PUBMED:12426313) ].

GO function:

hydrolase activity, acting on acid anhydrides (GO:0016817)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry SUV3_C