The domain within your query sequence starts at position 870 and ends at position 953; the E-value for the SWIRM-assoc_1 domain shown below is 2.5e-34.
AAALASAATKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREKEALEQ QRQQLLTERQNFHMEQLKYAELRA
SWIRM-assoc_1 |
 |
|---|
| PFAM accession number: | PF16495 |
|---|---|
| Interpro abstract (IPR032451): | This entry represents a conserved region found in the SWI/SNF complex subunit SMARCC 1/2, Ssr1/2 and SWI3 proteins. The function of this domain is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SWIRM-assoc_1