The domain within your query sequence starts at position 684 and ends at position 750; the E-value for the SWIRM-assoc_3 domain shown below is 4.1e-34.
VDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVEEAAKVTGKADPAFGLESSGIAGT ASDEPER
SWIRM-assoc_3 |
---|
PFAM accession number: | PF16498 |
---|---|
Interpro abstract (IPR032448): | This conserved domain can be found after the SWIRM and SANT domains in SWI/SNF complex subunits SMARCC1 (BAF155) and SMARCC2 (BAF170) [ (PUBMED:23996527) ]. The function of this domain is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SWIRM-assoc_3