The domain within your query sequence starts at position 705 and ends at position 771; the E-value for the SWIRM-assoc_3 domain shown below is 9.6e-35.
VDPRVASAAAKAALEEFSRVREEVPLELVEAHVKKVQEAARASGKVDPTYGLESSCIAGT GPDEPEK
SWIRM-assoc_3 |
 |
|---|
| PFAM accession number: | PF16498 |
|---|---|
| Interpro abstract (IPR032448): | This conserved domain can be found after the SWIRM and SANT domains in SWI/SNF complex subunits SMARCC1 (BAF155) and SMARCC2 (BAF170) [ (PUBMED:23996527) ]. The function of this domain is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SWIRM-assoc_3