The domain within your query sequence starts at position 45 and ends at position 135; the E-value for the SYCE1 domain shown below is 4.4e-39.
GSLEPQIEDLIHRINELQQGPAKKRSSEELGEAQALQEAMHRELDSLNEERVHLEEVLRK KQEAVSILKKHPQERDSDTPQKCTVQFSGFR
SYCE1 |
 |
|---|
| PFAM accession number: | PF15233 |
|---|---|
| Interpro abstract (IPR026676): | Synaptonemal complex central element protein 1 is a major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. It requires the transverse filament protein-SYCP1 in order to be incorporated into the central element. It may have a role in the synaptonemal complex assembly, stabilisation and recombination [ (PUBMED:15944401) ]. |
| GO process: | synaptonemal complex assembly (GO:0007130), synaptonemal complex organization (GO:0070193) |
| GO component: | synaptonemal complex (GO:0000795) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SYCE1