SMART: Pfam domain Sad1

The domain within your query sequence starts at position 777 and ends at position 911; the E-value for the Sad1_UNC domain shown below is 2.2e-48.

LWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMKIYPTTFTMEHIPKTLSPTGNIS
SAPKDFAVYGLETEYQEEGQPLGRFTYDQEGDSLQMFHTLERPDQAFQIVELRVLSNWGH
PEYTCLYRFRVHGEP

Sad1_UNC

PFAM accession number:	PF07738
Interpro abstract (IPR012919):	Sad1/UNC-84 (SUN)-domain proteins are inner nuclear membrane (INM) proteins that are part of bridging complexes linking cytoskeletal elements with the nucleoskeleton. Originaly identified based on an ~150-amino acid region of homology between the C terminus of the Schizosaccharomyces pombe Sad1 protein and the Caenorhabditis elegans UNC-84 protein, SUN proteins are present in the proteomes of most eucaryotes. In addition to the SUN domain, these proteins contain a transmembrane sequence and at least one coiled-coil domain and localise to the inner nuclear envelope. SUN proteins are anchored in the inner nuclear envelope by their transmembrane segment and oriented in the membrane such that the C-terminal SUN domain is located in the space between the inner and outer nuclear membrane. Here, the SUN domain can interact with the C- terminal tail of an outer nuclear envelope protein that binds to the cytoskeleton, including the centrosome [ (PUBMED:15611647) (PUBMED:16923827) (PUBMED:19807882) ]. Some proteins known to contain a SUN domain are listed below: Fission yeast spindle pole body-associated protein Sad1. Yeast spindle pole body assembly component MPS3, essential for nuclear division and fusion. Yeast uncharacterised protein SLP1. Caenorhabditis nuclear migration and anchoring protein UNC-84. Caenorhabditis SUN domain-containing protein 1 (sun-1), involved in centrosome attachment to the nucleus. Mammalian sperm-associated antigen 4 protein (SPAG4), may assist the organisation and assembly of outer dense fibres (ODFs), a specific structure of the sperm tail. Mammalian sperm-associated antigen 4-like protein (SPAG4L). Mammalian SUN1. Mammalian SUN2. Mammalian SUN3.

PFAM accession number:

PF07738

Interpro abstract (IPR012919):

Sad1/UNC-84 (SUN)-domain proteins are inner nuclear membrane (INM) proteins that are part of bridging complexes linking cytoskeletal elements with the nucleoskeleton. Originaly identified based on an ~150-amino acid region of homology between the C terminus of the Schizosaccharomyces pombe Sad1 protein and the Caenorhabditis elegans UNC-84 protein, SUN proteins are present in the proteomes of most eucaryotes. In addition to the SUN domain, these proteins contain a transmembrane sequence and at least one coiled-coil domain and localise to the inner nuclear envelope. SUN proteins are anchored in the inner nuclear envelope by their transmembrane segment and oriented in the membrane such that the C-terminal SUN domain is located in the space between the inner and outer nuclear membrane. Here, the SUN domain can interact with the C- terminal tail of an outer nuclear envelope protein that binds to the cytoskeleton, including the centrosome [ (PUBMED:15611647) (PUBMED:16923827) (PUBMED:19807882) ].

Some proteins known to contain a SUN domain are listed below:

Fission yeast spindle pole body-associated protein Sad1.
Yeast spindle pole body assembly component MPS3, essential for nuclear division and fusion.
Yeast uncharacterised protein SLP1.
Caenorhabditis nuclear migration and anchoring protein UNC-84.
Caenorhabditis SUN domain-containing protein 1 (sun-1), involved in centrosome attachment to the nucleus.
Mammalian sperm-associated antigen 4 protein (SPAG4), may assist the organisation and assembly of outer dense fibres (ODFs), a specific structure of the sperm tail.
Mammalian sperm-associated antigen 4-like protein (SPAG4L).
Mammalian SUN1.
Mammalian SUN2.
Mammalian SUN3.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sad1_UNC