The domain within your query sequence starts at position 1 and ends at position 208; the E-value for the Sclerostin domain shown below is 8e-98.

MQPSLAPCLICLLVHAAFCAVEGQGWQAFRNDATEVIPGLGEYPEPPPENNQTMNRAENG
GRPPHHPYDAKDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRV
KWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDF
GPETARPQKGRKPRPGARGAKANQAELE

Sclerostin

• PFAM accession number: PF05463
• Interpro abstract (IPR008835):

  This sclerostin family consists of sclerostin and sclerostin domain-containing protein 1. Sclerostin (SOST) is thought to suppress bone formation. Mutations of the SOST gene lead to sclerosteosis, a progressive sclerosing bone dysplasia with an autosomal recessive mode of inheritance. Radiologically, it is characterised by a generalised hyperostosis and sclerosis leading to a markedly thickened and sclerotic skull, with mandible, ribs, clavicles and all long bones also being affected. Due to narrowing of the foramina of the cranial nerves, facial nerve palsy, hearing loss and atrophy of the optic nerves can occur. Sclerosteosis is clinically and radiologically very similar to van Buchem disease, mainly differentiated by hand malformations and a large stature in sclerosteosis patients [ (PUBMED:11181578) ]. Sclerostin domain-containing protein 1, also known as USAG1, is a bone morphogenetic protein antagonist [ (PUBMED:15020244) ].

• GO component: extracellular space (GO:0005615)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sclerostin