The domain within your query sequence starts at position 47 and ends at position 269; the E-value for the Scramblase domain shown below is 1.5e-79.
QPSSFLPTATLPPGLEYLSQLDLIIIHQQVELLGMILGTETSNKYEIKNSLGQRIYFAVE ESICFNRNVCSTLRACTLRITDNSGREVITVNRPLRCNSCWCPCYLQELEIQAPPGTIVG YVAQKWGPFQPKFTIQNANKEDILKIIGPCTTCGCFGDVDFEVKTVDEKVTIGKISKYWS GFVNDVFTNADNFGIHVPADLDVTLKAAMIGACFLFDFMFFEH
Scramblase |
---|
PFAM accession number: | PF03803 |
---|---|
Interpro abstract (IPR005552): | Scramblase is palmitoylated and contains a potential protein kinase C phosphorylation site. Scramblase exhibits Ca 2+ -activated phospholipid scrambling activity in vitro. There are also possible SH3 and WW binding motifs. Scramblase is involved in the redistribution of phospholipids after cell activation or injury [ (PUBMED:11487015) ]. |
GO process: | plasma membrane phospholipid scrambling (GO:0017121) |
GO function: | phospholipid scramblase activity (GO:0017128) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Scramblase