The domain within your query sequence starts at position 52 and ends at position 223; the E-value for the Sds3 domain shown below is 3.6e-30.
ASETDLAKHDEEDYVEMKEQMYQDKLASLKRQLQQLQEGTLQEYQKRMKKLDQQYRERIR NAELFLQLETEQVERNYIKEKKAAVKEFEDKKVELKENLIAELEEKKKMIENEKLTMELT GDSMEVKPIMTRKLRRRPNDPVPIPDKRRKPAPAQLNYLLTDEQIMEDLRTL
Sds3 |
---|
PFAM accession number: | PF08598 |
---|---|
Interpro abstract (IPR013907): | Repression of gene transcription is mediated by histone deacetylases containing repressor-co-repressor complexes, which are recruited to promoters of target genes via interactions with sequence-specific transcription factors. The co-repressor complex contains a core of at least seven proteins [ (PUBMED:15451426) ]. This entry represents the conserved region found in Sds3, Dep1 and BRMS1-homologue p40 proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sds3