The domain within your query sequence starts at position 79 and ends at position 244; the E-value for the Sec3_C domain shown below is 4.6e-13.
DLRHYSKQVELELQQIEQKSIRDYIQESENIASLHNQITACDAVLERMEQMLGAFQSDLS SISSEIRTLQEQSGAMNIRLRNRQAVRGKLGELVDGLVVPSALVTAILEAPVTEPRFLEQ LQELDAKAAAVREQEAMGTAACADVRGVLDRLRVKAVTKIREFILQ
Sec3_C |
---|
PFAM accession number: | PF09763 |
---|---|
Interpro abstract (IPR019160): | This entry represents the C-terminal domain of Sec3 (also known as Exoc1), a component of the exocyst complex (composed of Exoc1, Exoc2, Exoc3, Exoc4, Exoc5, Exoc6, Exoc7 and Exoc8). Sec3 binds to the C-terminal cytoplasmic domain of GLYT1 (glycine transporter protein 1). Sec3 is the exocyst component that is closest to the plasma membrane docking site and it serves as a spatial landmark in the plasma membrane for incoming secretory vesicles. Sec3 is recruited to the sites of polarised membrane growth through its interaction with Rho1p, a small GTP-binding protein [ (PUBMED:16181645) ]. |
GO process: | exocytosis (GO:0006887) |
GO component: | exocyst (GO:0000145) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sec3_C