The domain within your query sequence starts at position 24 and ends at position 144; the E-value for the Sec8_exocyst domain shown below is 1.1e-36.
LISVIRTLSTSDDVEDRENEKGRLEEAYEKCDRDLDELIVQHYTELTTAIRTYQSITERI TNSRNKIKQVKENLLSCKMLLHCKRDELRKLWIEGIEHKHVLNLLDEIENIKQVPQKLEQ C
Sec8_exocyst |
---|
PFAM accession number: | PF04048 |
---|---|
Interpro abstract (IPR007191): | Sec8 is a component of the exocyst complex involved in the docking of exocystic vesicles with a fusion site on the plasma membrane. The exocyst complex is composed of Sec3, Sec5, Sec6, Sec8, Sec10, Sec15, Exo70 and Exo84. |
GO process: | vesicle docking involved in exocytosis (GO:0006904) |
GO component: | exocyst (GO:0000145) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sec8_exocyst