The domain within your query sequence starts at position 20 and ends at position 116; the E-value for the Semialdhyde_dh domain shown below is 2.1e-8.
SVFILGASGETGKVLLKEILGQNLFSKVTLIGRRKLTFEEEAYKNVNQEVVDFEKLDVYA SAFQGHDVGFCCLGTTRSKAGAEGFVRVDRDYVLKSA
Semialdhyde_dh |
---|
PFAM accession number: | PF01118 |
---|---|
Interpro abstract (IPR000534): | The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [ (PUBMED:10369777) ], an enzyme involved in the biosynthesis of various amino acids from aspartate. This family is also found in yeast and fungal Arg5,6 protein, which is cleaved into the enzymes N-acety-gamma-glutamyl-phosphate reductase and acetylglutamate kinase. These are also involved in arginine biosynthesis. All proteins in this entry contain a NAD binding region of semialdehyde dehydrogenase. |
GO process: | oxidation-reduction process (GO:0055114) |
GO function: | NAD binding (GO:0051287), oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (GO:0016620) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Semialdhyde_dh