The domain within your query sequence starts at position 2 and ends at position 78; the E-value for the Serinc domain shown below is 7.3e-14.
MPSVLCAHLFGSSDCPVLSGSGAVYRVCAGTATFHLLQAVLLVRLHSPTNPRAQLHNSLA LYWHLWRLHIHPITAGA
Serinc |
---|
PFAM accession number: | PF03348 |
---|---|
Interpro abstract (IPR005016): | The serine incorporator/TMS membrane protein (TDE1/TMS) family include SERINC1-5 from mammals and membrane protein Tms1 from budding yeasts. Members in this family contain eleven transmembrane helices. SERINC1-5 function in incorporating serine into membranes and facilitating the synthesis of two serine-derived lipids, phosphatidylserine and sphingolipids [ (PUBMED:16120614) ]. Serinc3 (also known as TDE1) is overexpressed in tumours [ (PUBMED:16547497) ]. The function of Tms1 is not clear. |
GO component: | membrane (GO:0016020) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Serinc