SMART: Pfam domain Shugoshin

The domain within your query sequence starts at position 22 and ends at position 66; the E-value for the Shugoshin_N domain shown below is 6.2e-12.

MKEKRNKNLAGIGKRKSFIVAPGQVPTNTATLLRYYQDNNRLLVL

Shugoshin_N

PFAM accession number:	PF07558
Interpro abstract (IPR011516):	This entry represents the N-terminal domain of Shugoshin (Sgo1) kinetochore-attachment proteins. Shugoshin has this conserved coiled-coil N-terminal domain and a highly conserved C-terminal basic region ( IPR011515 ). Shugoshin is a crucial target of Bub1 kinase that plays a central role in chromosome cohesion during mitosis and meiosis divisions by preventing premature dissociation of cohesin complex from centromeres after prophase, when most of cohesin complex dissociates from chromosomes arms [ (PUBMED:14730319) (PUBMED:18987869) ]. Shugoshin is thought to act by protecting Rec8 and Rad21 at the centromeres from separase degradation during anaphase I (during meiosis) so that sister chromatids remain tethered [ (PUBMED:14730319) ]. Shugoshin also acts as a spindle checkpoint component required for sensing tension between sister chromatids during mitosis, its degradation when they separate preventing cell cycle arrest and chromosome loss in anaphase, a time when sister chromatids are no longer under tension. Human shugoshin is diffusible and mediates kinetochore-driven formation of kinetochore-microtubules during bipolar spindle assembly [ (PUBMED:16687935) ]. Further, the primary role of shugoshin is to ensure bipolar attachment of kinetochores, and its role in protecting cohesion has co-developed to facilitate this process [ (PUBMED:17322402) ].

PFAM accession number:

PF07558

Interpro abstract (IPR011516):

This entry represents the N-terminal domain of Shugoshin (Sgo1) kinetochore-attachment proteins. Shugoshin has this conserved coiled-coil N-terminal domain and a highly conserved C-terminal basic region ( IPR011515 ).

Shugoshin is a crucial target of Bub1 kinase that plays a central role in chromosome cohesion during mitosis and meiosis divisions by preventing premature dissociation of cohesin complex from centromeres after prophase, when most of cohesin complex dissociates from chromosomes arms [ (PUBMED:14730319) (PUBMED:18987869) ]. Shugoshin is thought to act by protecting Rec8 and Rad21 at the centromeres from separase degradation during anaphase I (during meiosis) so that sister chromatids remain tethered [ (PUBMED:14730319) ]. Shugoshin also acts as a spindle checkpoint component required for sensing tension between sister chromatids during mitosis, its degradation when they separate preventing cell cycle arrest and chromosome loss in anaphase, a time when sister chromatids are no longer under tension. Human shugoshin is diffusible and mediates kinetochore-driven formation of kinetochore-microtubules during bipolar spindle assembly [ (PUBMED:16687935) ]. Further, the primary role of shugoshin is to ensure bipolar attachment of kinetochores, and its role in protecting cohesion has co-developed to facilitate this process [ (PUBMED:17322402) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Shugoshin_N