The domain within your query sequence starts at position 1 and ends at position 152; the E-value for the Siva domain shown below is 6.6e-65.

MPKRSCGFADSALLQLKVHVGLKELSHGVFAERYSREVFERTKQLLFQGARAYRDHISSE
DCSVNHLRESLKSGVVGAPQPARGQMLIGPDGQLTWCQAQASEGGLPRTAPIACSSCMRS
VDGKAVCSQCERAGPVWAGCGSLACVLCGLAE

Siva

Siva
PFAM accession number:PF05458
Interpro abstract (IPR022773):

Siva binds to the CD27 cytoplasmic tail. It has a DD homology region, a box-B-like ring finger, and a zinc finger-like domain. Overexpression of Siva in various cell lines induces apoptosis, suggesting an important role for Siva in the CD27-transduced apoptotic pathway [ (PUBMED:9177220) ]. Siva-1 binds to and inhibits BCL-X(L)-mediated protection against UV radiation-induced apoptosis. Indeed, the unique amphipathic helical region (SAH) present in Siva-1 is required for its binding to BCL-X(L) and sensitising cells to UV radiation. Natural complexes of Siva-1/BCL-X(L) are detected in HUT78 and murine thymocyte, suggesting a potential role for Siva-1 in regulating T cell homeostasis [ (PUBMED:12011449) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Siva