The domain within your query sequence starts at position 61 and ends at position 168; the E-value for the Ski_Sno domain shown below is 3.2e-41.
QELQPYSGSSALKPNQVGETSLYGVPIVSLVIDGQERLCLAQISNTLLKNYSYNEIHNRR VALGITCVQCTPVQLEILRRAGAMPISSRRCGMITKREAERLCKSFLG
Ski_Sno |
![]() |
---|
PFAM accession number: | PF02437 |
---|---|
Interpro abstract (IPR003380): | This domain is about 100 amino acids long and contains a conserved CLPQ motif. The c-ski proto-oncogene has been shown to influence proliferation, morphological transformation and myogenic differentiation [ (PUBMED:7999783) ]. Sno, a Ski proto-oncogene homologue, is expressed in two isoforms and plays a role in the response to proliferation stimuli. Dachshund also contains this domain. It is involved in various aspects of development [ (PUBMED:7821215) (PUBMED:11290302) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ski_Sno