The domain within your query sequence starts at position 88 and ends at position 228; the E-value for the Sororin domain shown below is 4.1e-31.
ENNPPLKVPTKEDLFKTCSVPGTPSSTPVLYTQNVEPDSGEAELDSRDLEMSQKVRRSYS RLQSLGCASTSTPGRRSFFGFEGPDDLPGVSPVVCSKLIETPKVPAKDLVPARTKDLVPD STKDLVPARTLPGISPPVVKE
Sororin |
![]() |
---|
PFAM accession number: | PF09666 |
---|---|
Interpro abstract (IPR018605): | Sororin is an essential, cell cycle-dependent mediator of sister chromatid cohesion [ (PUBMED:15837422) ]. The protein is nuclear in interphase cells, dispersed from the chromatin in mitosis, and interacts with the cohesin complex [ (PUBMED:15837422) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sororin