The domain within your query sequence starts at position 559 and ends at position 697; the E-value for the SoxG domain shown below is 1.3e-10.
NISHMLTPRGRVYAELTVSQQSPGEFLLITGSGSELHDLRWIEEAAFRGGYDVEIQNITD EFGVLGVAGPYARRVLQKLTSEDLSDDAFKFLQTKSFNISDIPVTAIRISYTGELGWELY HRREDSATLYERIMSAGQE
SoxG |
---|
PFAM accession number: | PF04268 |
---|---|
Interpro abstract (IPR007375): | Sarcosine oxidase is a hetero-tetrameric enzyme that contains both covalently bound FMN and non-covalently bound FAD and NAD + . This enzyme catalyzes the oxidative demethylation of sarcosine to yield glycine, H 2 O 2 and 5,10-CH2-tetrahydrofolate (H4folate) in a reaction requiring H4folate and O 2 [ (PUBMED:11330998) (PUBMED:7543100) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SoxG