The domain within your query sequence starts at position 3 and ends at position 87; the E-value for the Sox_N domain shown below is 3.3e-25.
DMSEARAQPPCSPSGTASSMSHVEDSDSDAPPSPAGSEGLGRAGGGGRGDTAEAADERFP ACIRDAVSQVLKGYDWSLVPMPVRG
Sox_N |
---|
PFAM accession number: | PF12444 |
---|---|
Interpro abstract (IPR022151): | This domain is found in eukaryotes, and is typically between 69 and 88 amino acids in length. It is found in association with . It contains two conserved sequence motifs: YDW and PVR. It is found in Sox8 [ (PUBMED:16943273) ], Sox9 [ (PUBMED:15818483) ] and Sox10 [ (PUBMED:9412504) ] proteins, which have structural similarity. Sox proteins are involved in developmental processes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sox_N