The domain within your query sequence starts at position 205 and ends at position 399; the E-value for the Spond_N domain shown below is 7.5e-74.
AKYRLTFYGNWSEKTHPKDYPRRANHWSAIIGGSHSKNYVLWEYGGYASEGVKQVAELGS PVKMEEEIRQQSDEVLTVIKAKAQWPAWQPVNVRAAPSAEFSVDRTRHLMSFLTMMGPSP DWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQEKIRPLTSLDH PQSPFYDPEGGSITQ
Spond_N |
---|
PFAM accession number: | PF06468 |
---|---|
Interpro abstract (IPR009465): | This conserved region is found in the N-terminal half of several Spondin proteins [ (PUBMED:19153605) ]. Spondins are involved in patterning axonal growth trajectory through either inhibiting or promoting adhesion of embryonic nerve cells [ (PUBMED:11287656) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Spond_N