The domain within your query sequence starts at position 1 and ends at position 149; the E-value for the Spot_14 domain shown below is 2.7e-56.
MQVLTKRYPKNCLLTVMDRYSAVVRNMEQVVMIPSLLRDVQLSGPGGSVQDGAPDLYTYF TMLKSICVEVDHGLLPREEWQAKVAGNETSEAENDAAETEEAEEDRISEELDLEAQFHLH FCSLHHILTHLTRKAQEVTRKYQEMTGQV
Spot_14 |
---|
PFAM accession number: | PF07084 |
---|---|
Interpro abstract (IPR009786): | The Spot 14 family includes thyroid hormone-inducible hepatic protein (Spot 14), Mid1-interacting protein and related sequneces. Mainly expressed in tissues that synthesise triglycerides, the mRNA coding for Spot 14 has been shown to be increased in rat liver by insulin, dietary carbohydrates, glucose in hepatocyte culture medium, as well as thyroid hormone. In contrast, dietary fats and polyunsaturated fatty acids, have been shown to decrease the amount of Spot 14 mRNA, while an elevated level of cAMP acts as a dominant negative factor. In addition, liver-specific factors or chromatin organisation of the gene have been shown to contribute to the regulation of its expression [ (PUBMED:9003802) ]. Spot 14 protein is thought to be required for induction of hepatic lipogenesis [ (PUBMED:11564699) ]. Mid1-interacting protein is involved in stabilisation of microtubules [ (PUBMED:15070402) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Spot_14